Lineage for d1iqcb1 (1iqc B:1-150)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305000Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 2305001Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 2305002Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry)
  8. 2305005Domain d1iqcb1: 1iqc B:1-150 [66268]
    complexed with ca, gol, hem, mg

Details for d1iqcb1

PDB Entry: 1iqc (more details), 1.8 Å

PDB Description: crystal structure of di-heme peroxidase from nitrosomonas europaea
PDB Compounds: (B:) di-heme peroxidase

SCOPe Domain Sequences for d1iqcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqcb1 a.3.1.5 (B:1-150) Di-heme cytochrome c peroxidase {Nitrosomonas europaea [TaxId: 915]}
anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
rerfkkvfgsdevtidrittaiaqfeetlv

SCOPe Domain Coordinates for d1iqcb1:

Click to download the PDB-style file with coordinates for d1iqcb1.
(The format of our PDB-style files is described here.)

Timeline for d1iqcb1: