Lineage for d1ip7b_ (1ip7 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1887055Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1887115Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1887828Species Human (Homo sapiens) [TaxId:9606] [53969] (201 PDB entries)
    Uniprot P00695
  8. 1887999Domain d1ip7b_: 1ip7 B: [66254]
    complexed with na

Details for d1ip7b_

PDB Entry: 1ip7 (more details), 1.9 Å

PDB Description: g129a human lysozyme
PDB Compounds: (B:) Lysozyme C

SCOPe Domain Sequences for d1ip7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ip7b_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcav

SCOPe Domain Coordinates for d1ip7b_:

Click to download the PDB-style file with coordinates for d1ip7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ip7b_: