Lineage for d1ip3b_ (1ip3 B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.2: Lysozyme-like [53954] (1 superfamily) Superfamily d.2.1: Lysozyme-like [53955] (7 families) 
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) Protein Lysozyme [53961] (16 species) 
Species Human (Homo sapiens) [TaxId:9606] [53969] (183 PDB entries) 
Domain d1ip3b_: 1ip3 B: [66249]
Details for d1ip3b_
PDB Entry: 1ip3 (more details), 1.8 Å
PDB Description: g68a human lysozyme
SCOP Domain Sequences for d1ip3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ip3b_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens)}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndaktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv
SCOP Domain Coordinates for d1ip3b_:
Click to download the PDB-style file with coordinates for d1ip3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ip3b_:
- d1ip3b_ first appeared in SCOP 1.59
- d1ip3b_ appears in SCOP 1.63
- d1ip3b_ appears in the current release, SCOPe 2.08
View in 3D
