Lineage for d1iokg1 (1iok G:2-136,G:410-526)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156642Fold a.129: GroEL-like chaperone, ATPase domain [48591] (1 superfamily)
  4. 156643Superfamily a.129.1: GroEL-like chaperone, ATPase domain [48592] (2 families) (S)
  5. 156644Family a.129.1.1: GroEL [48593] (1 protein)
  6. 156645Protein GroEL [48594] (2 species)
  7. 156683Species Paracoccus denitrificans [TaxId:266] [69116] (1 PDB entry)
  8. 156690Domain d1iokg1: 1iok G:2-136,G:410-526 [66242]
    Other proteins in same PDB: d1ioka2, d1ioka3, d1iokb2, d1iokb3, d1iokc2, d1iokc3, d1iokd2, d1iokd3, d1ioke2, d1ioke3, d1iokf2, d1iokf3, d1iokg2, d1iokg3

Details for d1iokg1

PDB Entry: 1iok (more details), 3.2 Å

PDB Description: crystal structure of chaperonin-60 from paracoccus denitrificans

SCOP Domain Sequences for d1iokg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iokg1 a.129.1.1 (G:2-136,G:410-526) GroEL {Paracoccus denitrificans}
aakevkfnsdardrmlkgvniladavkvtlgpkgrnvvidksfgapritkdgvsvakeie
lsdkfenmgaqmvrevasrtndeagdgtttatvlaqaivreglkavaagmnpmdlkrgid
vatakvveaiksaarXgivvgggvalvqgakvleglsgansdqdagiaiirraleapmrq
iaenagvdgavvagkvressdkafgfnaqteeygdmfkfgvidpakvvrtaledaasvag
llitteamiaekp

SCOP Domain Coordinates for d1iokg1:

Click to download the PDB-style file with coordinates for d1iokg1.
(The format of our PDB-style files is described here.)

Timeline for d1iokg1: