Lineage for d1iokf3 (1iok F:137-190,F:367-409)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256999Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 257000Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 257001Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 257002Protein GroEL, I domain [54851] (2 species)
  7. 257040Species Paracoccus denitrificans [TaxId:266] [69717] (1 PDB entry)
  8. 257046Domain d1iokf3: 1iok F:137-190,F:367-409 [66241]
    Other proteins in same PDB: d1ioka1, d1ioka2, d1iokb1, d1iokb2, d1iokc1, d1iokc2, d1iokd1, d1iokd2, d1ioke1, d1ioke2, d1iokf1, d1iokf2, d1iokg1, d1iokg2

Details for d1iokf3

PDB Entry: 1iok (more details), 3.2 Å

PDB Description: crystal structure of chaperonin-60 from paracoccus denitrificans

SCOP Domain Sequences for d1iokf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iokf3 d.56.1.1 (F:137-190,F:367-409) GroEL, I domain {Paracoccus denitrificans}
pvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenkgmetevevvXervak
laggvavirvggmteievkerkdrvddalnatraavqe

SCOP Domain Coordinates for d1iokf3:

Click to download the PDB-style file with coordinates for d1iokf3.
(The format of our PDB-style files is described here.)

Timeline for d1iokf3: