Lineage for d1iokf2 (1iok F:191-366)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851157Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2851158Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 2851159Protein GroEL, A domain [52031] (4 species)
  7. 2851315Species Paracoccus denitrificans [TaxId:266] [69430] (1 PDB entry)
  8. 2851321Domain d1iokf2: 1iok F:191-366 [66240]
    Other proteins in same PDB: d1ioka1, d1ioka3, d1iokb1, d1iokb3, d1iokc1, d1iokc3, d1iokd1, d1iokd3, d1ioke1, d1ioke3, d1iokf1, d1iokf3, d1iokg1, d1iokg3

Details for d1iokf2

PDB Entry: 1iok (more details), 3.2 Å

PDB Description: crystal structure of chaperonin-60 from paracoccus denitrificans
PDB Compounds: (F:) chaperonin 60

SCOPe Domain Sequences for d1iokf2:

Sequence, based on SEQRES records: (download)

>d1iokf2 c.8.5.1 (F:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]}
egmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesviqsqkplliv
aedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqvisedlgmkle
nvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdydreklq

Sequence, based on observed residues (ATOM records): (download)

>d1iokf2 c.8.5.1 (F:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]}
egmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivaedveiaavka
pgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiearvsqirqqi
eettsdydreklq

SCOPe Domain Coordinates for d1iokf2:

Click to download the PDB-style file with coordinates for d1iokf2.
(The format of our PDB-style files is described here.)

Timeline for d1iokf2: