Lineage for d1ioke3 (1iok E:137-190,E:367-409)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191873Fold d.56: GroEL-like chaperone, intermediate domain [54848] (1 superfamily)
  4. 191874Superfamily d.56.1: GroEL-like chaperone, intermediate domain [54849] (2 families) (S)
  5. 191875Family d.56.1.1: GroEL [54850] (1 protein)
  6. 191876Protein GroEL [54851] (2 species)
  7. 191914Species Paracoccus denitrificans [TaxId:266] [69717] (1 PDB entry)
  8. 191919Domain d1ioke3: 1iok E:137-190,E:367-409 [66238]
    Other proteins in same PDB: d1ioka1, d1ioka2, d1iokb1, d1iokb2, d1iokc1, d1iokc2, d1iokd1, d1iokd2, d1ioke1, d1ioke2, d1iokf1, d1iokf2, d1iokg1, d1iokg2

Details for d1ioke3

PDB Entry: 1iok (more details), 3.2 Å

PDB Description: crystal structure of chaperonin-60 from paracoccus denitrificans

SCOP Domain Sequences for d1ioke3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioke3 d.56.1.1 (E:137-190,E:367-409) GroEL {Paracoccus denitrificans}
pvndssevaqvgtisangesfigqqiaeamqrvgnegvitveenkgmetevevvXervak
laggvavirvggmteievkerkdrvddalnatraavqe

SCOP Domain Coordinates for d1ioke3:

Click to download the PDB-style file with coordinates for d1ioke3.
(The format of our PDB-style files is described here.)

Timeline for d1ioke3: