Lineage for d1iokc2 (1iok C:191-366)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240180Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 240287Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 240288Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 240289Protein GroEL, A domain [52031] (3 species)
  7. 240338Species Paracoccus denitrificans [TaxId:266] [69430] (1 PDB entry)
  8. 240341Domain d1iokc2: 1iok C:191-366 [66231]
    Other proteins in same PDB: d1ioka1, d1ioka3, d1iokb1, d1iokb3, d1iokc1, d1iokc3, d1iokd1, d1iokd3, d1ioke1, d1ioke3, d1iokf1, d1iokf3, d1iokg1, d1iokg3

Details for d1iokc2

PDB Entry: 1iok (more details), 3.2 Å

PDB Description: crystal structure of chaperonin-60 from paracoccus denitrificans

SCOP Domain Sequences for d1iokc2:

Sequence, based on SEQRES records: (download)

>d1iokc2 c.8.5.1 (C:191-366) GroEL, A domain {Paracoccus denitrificans}
egmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesviqsqkplliv
aedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqvisedlgmkle
nvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdydreklq

Sequence, based on observed residues (ATOM records): (download)

>d1iokc2 c.8.5.1 (C:191-366) GroEL, A domain {Paracoccus denitrificans}
egmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivaedveiaavka
pgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiearvsqirqqi
eettsdydreklq

SCOP Domain Coordinates for d1iokc2:

Click to download the PDB-style file with coordinates for d1iokc2.
(The format of our PDB-style files is described here.)

Timeline for d1iokc2: