![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) ![]() |
![]() | Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
![]() | Protein GroEL, A domain [52031] (4 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [69430] (1 PDB entry) |
![]() | Domain d1ioka2: 1iok A:191-366 [66225] Other proteins in same PDB: d1ioka1, d1ioka3, d1iokb1, d1iokb3, d1iokc1, d1iokc3, d1iokd1, d1iokd3, d1ioke1, d1ioke3, d1iokf1, d1iokf3, d1iokg1, d1iokg3 |
PDB Entry: 1iok (more details), 3.2 Å
SCOPe Domain Sequences for d1ioka2:
Sequence, based on SEQRES records: (download)
>d1ioka2 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]} egmqfdrgylspyfvtnadkmiaeledayillhekklsslqpmvpllesviqsqkplliv aedvegealatlvvnklrgglkiaavkapgfgdrrkamlqdiailtggqvisedlgmkle nvtidmlgrakkvsinkdnttivdgagekaeiearvsqirqqieettsdydreklq
>d1ioka2 c.8.5.1 (A:191-366) GroEL, A domain {Paracoccus denitrificans [TaxId: 266]} egmqfdrgylspyfvtnadkmiaeledayillhekklsslqpqkpllivaedveiaavka pgfgdrrkamlqdiailtggidmlgrakkvsinkdnttivdgagekaeiearvsqirqqi eettsdydreklq
Timeline for d1ioka2: