Lineage for d1imhd2 (1imh D:188-367)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223643Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 223784Superfamily b.2.5: p53-like transcription factors [49417] (6 families) (S)
  5. 223803Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 223837Protein T-cell transcription factor NFAT5 (TONEBP), DNA-binding domain [69185] (1 species)
  7. 223838Species Human (Homo sapiens) [TaxId:9606] [69186] (1 PDB entry)
  8. 223840Domain d1imhd2: 1imh D:188-367 [66217]
    Other proteins in same PDB: d1imhc1, d1imhd1

Details for d1imhd2

PDB Entry: 1imh (more details), 2.86 Å

PDB Description: tonebp/dna complex

SCOP Domain Sequences for d1imhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imhd2 b.2.5.3 (D:188-367) T-cell transcription factor NFAT5 (TONEBP), DNA-binding domain {Human (Homo sapiens)}
kkspmlcgqypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghne
pvvlqvfvgndsgrvkphgfyqacrvtgrnttpckevdiegttvievgldpsnnmtlavd
cvgilklrnadvearigiagskkkstrarlvfrvnimrkdgstltlqtpsspilctqpag

SCOP Domain Coordinates for d1imhd2:

Click to download the PDB-style file with coordinates for d1imhd2.
(The format of our PDB-style files is described here.)

Timeline for d1imhd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1imhd1