Lineage for d1imhd1 (1imh D:368-468)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160877Protein Transcription factor TONEBP, C-terminal domain [69170] (1 species)
  7. 160878Species Human (Homo sapiens) [TaxId:9606] [69171] (1 PDB entry)
  8. 160880Domain d1imhd1: 1imh D:368-468 [66216]
    Other proteins in same PDB: d1imhc2, d1imhd2

Details for d1imhd1

PDB Entry: 1imh (more details), 2.86 Å

PDB Description: tonebp/dna complex

SCOP Domain Sequences for d1imhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imhd1 b.1.1.5 (D:368-468) Transcription factor TONEBP, C-terminal domain {Human (Homo sapiens)}
vpeilkkslhscsvkgeeevfligknflkgtkvifqenvsdenswkseaeidmelfhqnh
livkvppyhdqhitlpvsvgiyvvtnagrshdvqpftytpd

SCOP Domain Coordinates for d1imhd1:

Click to download the PDB-style file with coordinates for d1imhd1.
(The format of our PDB-style files is described here.)

Timeline for d1imhd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1imhd2