Lineage for d1imhc2 (1imh C:188-367)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 105991Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 106094Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 106095Family b.2.5.1: p53-like transcription factors [49418] (11 proteins)
  6. 106167Protein Transcription factor TONEBP, DNA-binding domain [69185] (1 species)
  7. 106168Species Human (Homo sapiens) [TaxId:9606] [69186] (1 PDB entry)
  8. 106169Domain d1imhc2: 1imh C:188-367 [66215]
    Other proteins in same PDB: d1imhc1, d1imhd1

Details for d1imhc2

PDB Entry: 1imh (more details), 2.86 Å

PDB Description: tonebp/dna complex

SCOP Domain Sequences for d1imhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imhc2 b.2.5.1 (C:188-367) Transcription factor TONEBP, DNA-binding domain {Human (Homo sapiens)}
kkspmlcgqypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghne
pvvlqvfvgndsgrvkphgfyqacrvtgrnttpckevdiegttvievgldpsnnmtlavd
cvgilklrnadvearigiagskkkstrarlvfrvnimrkdgstltlqtpsspilctqpag

SCOP Domain Coordinates for d1imhc2:

Click to download the PDB-style file with coordinates for d1imhc2.
(The format of our PDB-style files is described here.)

Timeline for d1imhc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1imhc1