SCOPe 2.03: Domain d1im8a_: 1im8 A:

Lineage for d1im8a_ (1im8 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (2 proteins)

6. Protein Hypothetical protein HI0319 (YecO) [69545] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [69546] (1 PDB entry)
   structural genomics

8. Domain d1im8a_: 1im8 A: [66212]
   CASP4
   complexed with cl, sai

Details for d1im8a_

PDB Entry: 1im8, 2.2 Å

PDB Description: Crystal structure of YecO from Haemophilus influenzae (HI0319), a methyltransferase with a bound S-adenosylhomocysteine

PDB Compounds: (A:) YecO

SCOPe Domain Sequences for d1im8a_:

Sequence; same for both SEQRES and ATOM records:

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}
fifdenvaevfpdmiqrsvpgysniitaigmlaerfvtadsnvydlgcsrgaatlsarrn
inqpnvkiigidnsqpmvercrqhiaayhseipveilcndirhveiknasmvilnftlqf
lppedrialltkiyeglnpngvlvlsekfrfedtkinhllidlhhqfkrangyselevsq
krtalenvmrtdsiethkvrlknvgfsqvelwfqcfnfgsmiavk

Timeline for d1im8a_:

• d1im8a_ first appeared in SCOP 1.59
  
• d1im8a_ appears in SCOPe 2.02
  
• d1im8a_ appears in SCOPe 2.04
  
• d1im8a_ appears in the current release, SCOPe 2.08