Lineage for d1im8a_ (1im8 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1378745Family c.66.1.14: Hypothetical protein HI0319 (YecO) [69544] (2 proteins)
  6. 1378746Protein Hypothetical protein HI0319 (YecO) [69545] (1 species)
  7. 1378747Species Haemophilus influenzae [TaxId:727] [69546] (1 PDB entry)
    structural genomics
  8. 1378748Domain d1im8a_: 1im8 A: [66212]
    CASP4
    complexed with cl, sai

Details for d1im8a_

PDB Entry: 1im8 (more details), 2.2 Å

PDB Description: Crystal structure of YecO from Haemophilus influenzae (HI0319), a methyltransferase with a bound S-adenosylhomocysteine
PDB Compounds: (A:) YecO

SCOPe Domain Sequences for d1im8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}
fifdenvaevfpdmiqrsvpgysniitaigmlaerfvtadsnvydlgcsrgaatlsarrn
inqpnvkiigidnsqpmvercrqhiaayhseipveilcndirhveiknasmvilnftlqf
lppedrialltkiyeglnpngvlvlsekfrfedtkinhllidlhhqfkrangyselevsq
krtalenvmrtdsiethkvrlknvgfsqvelwfqcfnfgsmiavk

SCOPe Domain Coordinates for d1im8a_:

Click to download the PDB-style file with coordinates for d1im8a_.
(The format of our PDB-style files is described here.)

Timeline for d1im8a_: