SCOPe 2.05: Domain d1ikqa3: 1ikq A:252-394

Lineage for d1ikqa3 (1ikq A:252-394)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.5: Exotoxin A, middle domain [56864] (1 family)
   automatically mapped to Pfam PF09102

5. Family f.1.5.1: Exotoxin A, middle domain [56865] (1 protein)

6. Protein Exotoxin A, middle domain [56866] (1 species)
   six-helical domain

7. Species Pseudomonas aeruginosa [TaxId:287] [56867] (2 PDB entries)

8. Domain d1ikqa3: 1ikq A:252-394 [66187]
   Other proteins in same PDB: d1ikqa1, d1ikqa2
   complexed with cl, na

Details for d1ikqa3

PDB Entry: 1ikq, 1.62 Å

PDB Description: pseudomonas aeruginosa exotoxin a, wild type

PDB Compounds: (A:) exotoxin a

SCOPe Domain Sequences for d1ikqa3:

Sequence; same for both SEQRES and ATOM records:

>d1ikqa3 f.1.5.1 (A:252-394) Exotoxin A, middle domain {Pseudomonas aeruginosa [TaxId: 287]}
eggslaaltahqachlpletftrhrqprgweqleqcgypvqrlvalylaarlswnqvdqv
irnalaspgsggdlgeaireqpeqarlaltlaaaeserfvrqgtgndeagaanadvvslt
cpvaagecagpadsgdallerny

Timeline for d1ikqa3:

• d1ikqa3 first appeared in SCOP 1.59
  
• d1ikqa3 appears in SCOPe 2.04
  
• d1ikqa3 appears in SCOPe 2.06
  
• d1ikqa3 appears in the current release, SCOPe 2.08