![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.5: Exotoxin A, middle domain [56864] (1 family) ![]() automatically mapped to Pfam PF09102 |
![]() | Family f.1.5.1: Exotoxin A, middle domain [56865] (1 protein) |
![]() | Protein Exotoxin A, middle domain [56866] (1 species) six-helical domain |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [56867] (2 PDB entries) |
![]() | Domain d1ikpa3: 1ikp A:252-394 [66184] Other proteins in same PDB: d1ikpa1, d1ikpa2 complexed with cl, na; mutant |
PDB Entry: 1ikp (more details), 1.45 Å
SCOPe Domain Sequences for d1ikpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ikpa3 f.1.5.1 (A:252-394) Exotoxin A, middle domain {Pseudomonas aeruginosa [TaxId: 287]} eggslaaltahqachlpletftrhrqprgaeqleqcgypvqrlvalylaarlswnqvdqv irnalaspgsggdlgeaireqpeqarlaltlaaaeserfvrqgtgndeagaanadvvslt cpvaagecagpadsgdallerny
Timeline for d1ikpa3: