Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species) |
Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [69473] (1 PDB entry) |
Domain d1ik6a1: 1ik6 A:1-191 [66174] Other proteins in same PDB: d1ik6a2 structure determined on its own rather in the complex with E1-alpha |
PDB Entry: 1ik6 (more details), 2 Å
SCOP Domain Sequences for d1ik6a1:
Sequence, based on SEQRES records: (download)
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} vagvvmmanmakainmalheemerdervvvlgedvgkkggvflvteglyerfgpervidt plneggilgfamgmamaglkpvaeiqfvdfiwlgadellnhiaklryrsggnykaplvvr tpvgsgtrgglyhsnspeaifvhtpglvvvmpstpynakgllkaairgddpvvflepkil yrapreevpeg
>d1ik6a1 c.36.1.7 (A:1-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} vagvvmmanmakainmalheemerdervvvlgelvteglyerfgpervidtplneggilg famgmamaglkpvaeiqfvlgadellnhiaklrykaplvvrtpvgspeaifvhtpglvvv mpstpynakgllkaairgddpvvflepkilyrapreevpeg
Timeline for d1ik6a1: