Lineage for d1iiza_ (1iiz A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 595959Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 595960Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 595969Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 596021Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 596501Species Tasar silkworm (Antheraea mylitta) [TaxId:34739] [69627] (1 PDB entry)
    induced antibacterial protein
  8. 596502Domain d1iiza_: 1iiz A: [66153]

Details for d1iiza_

PDB Entry: 1iiz (more details), 2.4 Å

PDB Description: Crystal Structure of the Induced Antibacterial Protein from Tasar Silkworm, Antheraea mylitta

SCOP Domain Sequences for d1iiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iiza_ d.2.1.2 (A:) Lysozyme {Tasar silkworm (Antheraea mylitta)}
krftrcglvnelrkqgfdenlmrdwvclvenesarytdkianvnkngsrdyglfqindky
wcskgstpgkdcnvtcsqlltdditvastcakkiykrtkfdawsgwdnhcnhsnpdissc

SCOP Domain Coordinates for d1iiza_:

Click to download the PDB-style file with coordinates for d1iiza_.
(The format of our PDB-style files is described here.)

Timeline for d1iiza_: