Lineage for d1iioa_ (1iio A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280804Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 281330Superfamily a.39.4: Hypothetical protein MTH865 [69025] (1 family) (S)
  5. 281331Family a.39.4.1: Hypothetical protein MTH865 [69026] (1 protein)
  6. 281332Protein Hypothetical protein MTH865 [69027] (1 species)
  7. 281333Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [69028] (1 PDB entry)
  8. 281334Domain d1iioa_: 1iio A: [66150]

Details for d1iioa_

PDB Entry: 1iio (more details)

PDB Description: nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum

SCOP Domain Sequences for d1iioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iioa_ a.39.4.1 (A:) Hypothetical protein MTH865 {Archaeon Methanobacterium thermoautotrophicum}
gshmkmgvkedirgqiigalagadfpinspeelmaalpngpdttcksgdvelkasdagqv
ltaddfpfksaeevadtivnkagl

SCOP Domain Coordinates for d1iioa_:

Click to download the PDB-style file with coordinates for d1iioa_.
(The format of our PDB-style files is described here.)

Timeline for d1iioa_: