Lineage for d1ii2b2 (1ii2 B:2-200)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128765Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
  4. 128766Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 128767Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 128774Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) [68925] (2 species)
  7. 128781Species Trypanosoma cruzi [TaxId:5693] [69614] (1 PDB entry)
  8. 128783Domain d1ii2b2: 1ii2 B:2-200 [66149]
    Other proteins in same PDB: d1ii2a1, d1ii2b1

Details for d1ii2b2

PDB Entry: 1ii2 (more details), 2 Å

PDB Description: Crystal Structure of Phosphoenolpyruvate Carboxykinase (PEPCK) from Trypanosoma cruzi

SCOP Domain Sequences for d1ii2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ii2b2 c.109.1.1 (B:2-200) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-liase) {Trypanosoma cruzi}
pptihrnllspelvqwalkiekdsrltargalavmsyaktgrspldkrivdtddvrenvd
wgkvnmklseesfarvrkiakefldtrehlfvvdcfaghderyrlkvrvfttrpyhalfm
rdmlivptpeelatfgepdyviynageckadpsipgltsttcvalnfktreqvilgteya
gemkkgiltvmfelmpqmn

SCOP Domain Coordinates for d1ii2b2:

Click to download the PDB-style file with coordinates for d1ii2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ii2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ii2b1