Lineage for d1iexa1 (1iex A:1-388)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683481Family c.1.8.7: NagZ-like [51553] (2 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
  6. 683482Protein Beta-D-glucan exohydrolase, N-terminal domain [51554] (1 species)
    interdomain linker forms an additional, N-terminal strand
  7. 683483Species Barley (Hordeum vulgare) [TaxId:4513] [51555] (9 PDB entries)
  8. 683486Domain d1iexa1: 1iex A:1-388 [66127]
    Other proteins in same PDB: d1iexa2
    complexed with fuc, man, nag, tcb

Details for d1iexa1

PDB Entry: 1iex (more details), 2.2 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 4i,4iii,4v-s-trithiocellohexaose
PDB Compounds: (A:) beta-d-glucan glucohydrolase isoenzyme exo1

SCOP Domain Sequences for d1iexa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iexa1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]}
dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
npyadpamaeqlgkqehrdlareaarks

SCOP Domain Coordinates for d1iexa1:

Click to download the PDB-style file with coordinates for d1iexa1.
(The format of our PDB-style files is described here.)

Timeline for d1iexa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iexa2