Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId:4932] [68984] (2 PDB entries) |
Domain d1id3c_: 1id3 C: [66114] Other proteins in same PDB: d1id3a_, d1id3b_, d1id3d_, d1id3e_, d1id3f_, d1id3h_ protein/DNA complex; complexed with mn |
PDB Entry: 1id3 (more details), 3.1 Å
SCOPe Domain Sequences for d1id3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1id3c_ a.22.1.1 (C:) Histone H2A {Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId: 4932]} qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk ktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkksakat
Timeline for d1id3c_: