Lineage for d1iase_ (1ias E:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735452Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 735453Species Human (Homo sapiens) [TaxId:9606] [56145] (4 PDB entries)
  8. 735464Domain d1iase_: 1ias E: [66104]
    complexed with so4

Details for d1iase_

PDB Entry: 1ias (more details), 2.9 Å

PDB Description: cytoplasmic domain of unphosphorylated type i tgf-beta receptor crystallized without fkbp12
PDB Compounds: (E:) tgf-beta receptor type I

SCOP Domain Sequences for d1iase_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iase_ d.144.1.7 (E:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
ylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtccia
dlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfwe
iarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmaki
mrecwyangaarltalrikktlsqlsqqeg

SCOP Domain Coordinates for d1iase_:

Click to download the PDB-style file with coordinates for d1iase_.
(The format of our PDB-style files is described here.)

Timeline for d1iase_: