Lineage for d1iasd_ (1ias D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589482Protein Type I TGF-beta receptor R4 [56144] (1 species)
    TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases
  7. 2589483Species Human (Homo sapiens) [TaxId:9606] [56145] (32 PDB entries)
    Uniprot P36897 200-500 ! Uniprot P36897 201-503
  8. 2589521Domain d1iasd_: 1ias D: [66103]
    complexed with so4

Details for d1iasd_

PDB Entry: 1ias (more details), 2.9 Å

PDB Description: cytoplasmic domain of unphosphorylated type i tgf-beta receptor crystallized without fkbp12
PDB Compounds: (D:) tgf-beta receptor type I

SCOPe Domain Sequences for d1iasd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iasd_ d.144.1.7 (D:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
ylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtccia
dlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfwe
iarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmaki
mrecwyangaarltalrikktlsqlsqqeg

SCOPe Domain Coordinates for d1iasd_:

Click to download the PDB-style file with coordinates for d1iasd_.
(The format of our PDB-style files is described here.)

Timeline for d1iasd_: