Lineage for d1iasb_ (1ias B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197201Family d.144.1.1: Serine/threonin kinases [56113] (18 proteins)
  6. 197377Protein Type I TGF-beta receptor R4 [56144] (1 species)
  7. 197378Species Human (Homo sapiens) [TaxId:9606] [56145] (2 PDB entries)
  8. 197384Domain d1iasb_: 1ias B: [66101]

Details for d1iasb_

PDB Entry: 1ias (more details), 2.9 Å

PDB Description: cytoplasmic domain of unphosphorylated type i tgf-beta receptor crystallized without fkbp12

SCOP Domain Sequences for d1iasb_:

Sequence, based on SEQRES records: (download)

>d1iasb_ d.144.1.1 (B:) Type I TGF-beta receptor R4 {Human (Homo sapiens)}
isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
ylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtccia
dlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfwe
iarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmaki
mrecwyangaarltalrikktlsqlsqqegi

Sequence, based on observed residues (ATOM records): (download)

>d1iasb_ d.144.1.1 (B:) Type I TGF-beta receptor R4 {Human (Homo sapiens)}
isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
ylnrytvtvegmiklalstasglahlhmeigkpaiahrdlksknilvkkngtcciadlgl
avrhdsatdtidihrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarrcsi
ggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrecwya
ngaarltalrikktlsqlsqqegi

SCOP Domain Coordinates for d1iasb_:

Click to download the PDB-style file with coordinates for d1iasb_.
(The format of our PDB-style files is described here.)

Timeline for d1iasb_: