Lineage for d1i8qa2 (1i8q A:171-248)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160772Protein Hyaluronate lyase precatalytic domain [69167] (1 species)
  7. 160773Species Streptococcus agalactiae [TaxId:1311] [69168] (2 PDB entries)
  8. 160775Domain d1i8qa2: 1i8q A:171-248 [66091]
    Other proteins in same PDB: d1i8qa1, d1i8qa3, d1i8qa4

Details for d1i8qa2

PDB Entry: 1i8q (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan

SCOP Domain Sequences for d1i8qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8qa2 b.1.1.5 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae}
sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
dksgkiikevplsvtast

SCOP Domain Coordinates for d1i8qa2:

Click to download the PDB-style file with coordinates for d1i8qa2.
(The format of our PDB-style files is described here.)

Timeline for d1i8qa2: