| Class b: All beta proteins [48724] (110 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
| Species Anti ssDNA Fab, (mouse), kappa L chain [69142] (1 PDB entry) |
| Domain d1i8mh1: 1i8m H:1-113 [66086] Other proteins in same PDB: d1i8ma2, d1i8mb2, d1i8mh2, d1i8ml2 |
PDB Entry: 1i8m (more details), 2.1 Å
SCOP Domain Sequences for d1i8mh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8mh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti ssDNA Fab, (mouse), kappa L chain}
qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
Timeline for d1i8mh1: