SCOP 1.71: Domain d1i8mb2: 1i8m B:114-213

Lineage for d1i8mb2 (1i8m B:114-213)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1i8mb2: 1i8m B:114-213 [66085]
   Other proteins in same PDB: d1i8ma1, d1i8ma2, d1i8mb1, d1i8mh1, d1i8ml1, d1i8ml2
   part of anti-ssDNA Fab
   complexed with so4

Details for d1i8mb2

PDB Entry: 1i8m, 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mb2:

Sequence, based on SEQRES records:

>d1i8mb2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1i8mb2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1i8mb2:

• d1i8mb2 first appeared in SCOP 1.59
  
• d1i8mb2 appears in SCOP 1.69
  
• d1i8mb2 appears in SCOP 1.73
  
• d1i8mb2 appears in the current release, SCOPe 2.08