SCOP 1.59: Domain d1i8mb2: 1i8m B:114-213

Lineage for d1i8mb2 (1i8m B:114-213)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Anti ssDNA Fab, (mouse), kappa L chain [69153] (1 PDB entry)

8. Domain d1i8mb2: 1i8m B:114-213 [66085]
   Other proteins in same PDB: d1i8ma1, d1i8mb1, d1i8mh1, d1i8ml1

Details for d1i8mb2

PDB Entry: 1i8m, 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mb2:

Sequence, based on SEQRES records:

>d1i8mb2 b.1.1.2 (B:114-213) Immunoglobulin (constant domains of L and H chains) {Anti ssDNA Fab, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1i8mb2 b.1.1.2 (B:114-213) Immunoglobulin (constant domains of L and H chains) {Anti ssDNA Fab, (mouse), kappa L chain}
akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1i8mb2:

• d1i8mb2 is new in SCOP 1.59
  
• d1i8mb2 appears in SCOP 1.61
  
• d1i8mb2 appears in the current release, SCOPe 2.08