SCOP 1.61: Domain d1i8mb1: 1i8m B:1-113

Lineage for d1i8mb1 (1i8m B:1-113)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anti ssDNA Fab, (mouse), kappa L chain [69142] (1 PDB entry)

8. Domain d1i8mb1: 1i8m B:1-113 [66084]
   Other proteins in same PDB: d1i8ma2, d1i8mb2, d1i8mh2, d1i8ml2

Details for d1i8mb1

PDB Entry: 1i8m, 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mb1:

Sequence; same for both SEQRES and ATOM records:

>d1i8mb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Anti ssDNA Fab, (mouse), kappa L chain}
qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss

Timeline for d1i8mb1:

• d1i8mb1 first appeared in SCOP 1.59
  
• d1i8mb1 appears in SCOP 1.63
  
• d1i8mb1 appears in the current release, SCOPe 2.08