Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins) |
Protein Chalcone synthase [53915] (1 species) |
Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries) |
Domain d1i89b2: 1i89 B:236-389 [66077] mutant |
PDB Entry: 1i89 (more details), 1.86 Å
SCOP Domain Sequences for d1i89b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i89b2 c.95.1.2 (B:236-389) Chalcone synthase {Alfalfa (Medicago sativa)} ifemvwtaqtiapdsegaidlhlreagltfhllkdvpgivsknitkalveafeplgisdy nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq nglkttgeglewgvlfgfgpgltietvvlrsvai
Timeline for d1i89b2: