Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (157 PDB entries) |
Domain d1i7ue_: 1i7u E: [66067] Other proteins in same PDB: d1i7ua1, d1i7ua2, d1i7ud1, d1i7ud2 |
PDB Entry: 1i7u (more details), 1.8 Å
SCOP Domain Sequences for d1i7ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7ue_ b.1.1.2 (E:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1i7ue_: