Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries) Uniprot P01892 25-298 |
Domain d1i7ud2: 1i7u D:1-181 [66066] Other proteins in same PDB: d1i7ua1, d1i7ub_, d1i7ud1, d1i7ue_ |
PDB Entry: 1i7u (more details), 1.8 Å
SCOPe Domain Sequences for d1i7ud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7ud2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d1i7ud2:
View in 3D Domains from other chains: (mouse over for more information) d1i7ua1, d1i7ua2, d1i7ub_, d1i7ue_ |