Lineage for d1i7ud2 (1i7u D:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198044Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
    Uniprot P01892 25-298
  8. 1198075Domain d1i7ud2: 1i7u D:1-181 [66066]
    Other proteins in same PDB: d1i7ua1, d1i7ub_, d1i7ud1, d1i7ue_

Details for d1i7ud2

PDB Entry: 1i7u (more details), 1.8 Å

PDB Description: crystal structure of class i mhc a2 in complex with peptide p1049-6v
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1i7ud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i7ud2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1i7ud2:

Click to download the PDB-style file with coordinates for d1i7ud2.
(The format of our PDB-style files is described here.)

Timeline for d1i7ud2: