| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries) Uniprot P01892 25-298 |
| Domain d1i7ua2: 1i7u A:1-181 [66063] Other proteins in same PDB: d1i7ua1, d1i7ub_, d1i7ud1, d1i7ue_ |
PDB Entry: 1i7u (more details), 1.8 Å
SCOPe Domain Sequences for d1i7ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7ua2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r
Timeline for d1i7ua2:
View in 3DDomains from other chains: (mouse over for more information) d1i7ub_, d1i7ud1, d1i7ud2, d1i7ue_ |