SCOP 1.73: Domain d1i7ua2: 1i7u A:1-181

Lineage for d1i7ua2 (1i7u A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries)

8. Domain d1i7ua2: 1i7u A:1-181 [66063]
   Other proteins in same PDB: d1i7ua1, d1i7ub_, d1i7ud1, d1i7ue_

Details for d1i7ua2

PDB Entry: 1i7u, 1.8 Å

PDB Description: crystal structure of class i mhc a2 in complex with peptide p1049-6v

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d1i7ua2:

Sequence; same for both SEQRES and ATOM records:

>d1i7ua2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1i7ua2:

• d1i7ua2 first appeared in SCOP 1.59
  
• d1i7ua2 appears in SCOP 1.71
  
• d1i7ua2 appears in SCOP 1.75
  
• d1i7ua2 appears in the current release, SCOPe 2.08