![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins) |
![]() | Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species) |
![]() | Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries) |
![]() | Domain d1i7ua2: 1i7u A:1-181 [66063] Other proteins in same PDB: d1i7ua1, d1i7ub1, d1i7ud1, d1i7ue1 |
PDB Entry: 1i7u (more details), 1.8 Å
SCOP Domain Sequences for d1i7ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7ua2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d1i7ua2:
![]() Domains from other chains: (mouse over for more information) d1i7ub1, d1i7ud1, d1i7ud2, d1i7ue1 |