SCOP 1.63: Domain d1i7ta1: 1i7t A:182-275

Lineage for d1i7ta1 (1i7t A:182-275)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries)

8. Domain d1i7ta1: 1i7t A:182-275 [66056]
   Other proteins in same PDB: d1i7ta2, d1i7td2

Details for d1i7ta1

PDB Entry: 1i7t, 2.8 Å

PDB Description: crystal structure of class i mhc a2 in complex with peptide p1049-5v

SCOP Domain Sequences for d1i7ta1:

Sequence; same for both SEQRES and ATOM records:

>d1i7ta1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1i7ta1:

• d1i7ta1 first appeared in SCOP 1.59
  
• d1i7ta1 appears in SCOP 1.61
  
• d1i7ta1 appears in SCOP 1.65
  
• d1i7ta1 appears in the current release, SCOPe 2.08