Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (29 PDB entries) |
Domain d1i7rd1: 1i7r D:182-275 [66053] Other proteins in same PDB: d1i7ra2, d1i7rd2 |
PDB Entry: 1i7r (more details), 2.2 Å
SCOP Domain Sequences for d1i7rd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7rd1 b.1.1.2 (D:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwe
Timeline for d1i7rd1:
View in 3D Domains from other chains: (mouse over for more information) d1i7ra1, d1i7ra2, d1i7rb_, d1i7re_ |