SCOPe 2.03: Domain d1i7pa1: 1i7p A:29-153

Lineage for d1i7pa1 (1i7p A:29-153)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein cytochrome b5 reductase [50427] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69273] (3 PDB entries)
   Uniprot P20070 33-300

8. Domain d1i7pa1: 1i7p A:29-153 [66048]
   Other proteins in same PDB: d1i7pa2
   complexed with fad

Details for d1i7pa1

PDB Entry: 1i7p, 2 Å

PDB Description: crystal structure of rat b5r in complex with fad

PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1i7pa1:

Sequence; same for both SEQRES and ATOM records:

>d1i7pa1 b.43.4.2 (A:29-153) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hhhmitlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnl
virpytpvssdddkgfvdlvvkvyfkethpkfpaggkmsqylenmnigdtiefrgpngll
vyqgk

Timeline for d1i7pa1:

• d1i7pa1 first appeared in SCOP 1.59
  
• d1i7pa1 appears in SCOPe 2.02
  
• d1i7pa1 appears in SCOPe 2.04
  
• d1i7pa1 appears in the current release, SCOPe 2.08