Lineage for d1i6da_ (1i6d A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904708Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 904709Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 904710Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 904799Protein Cytochrome c552 [46636] (5 species)
  7. 904810Species Paracoccus denitrificans [TaxId:266] [46639] (5 PDB entries)
  8. 904819Domain d1i6da_: 1i6d A: [66038]
    complexed with hec

Details for d1i6da_

PDB Entry: 1i6d (more details)

PDB Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state
PDB Compounds: (A:) cytochrome c552

SCOPe Domain Sequences for d1i6da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6da_ a.3.1.1 (A:) Cytochrome c552 {Paracoccus denitrificans [TaxId: 266]}
madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
alqefltnpkavvkgtkmafaglpkiedranliaylegqq

SCOPe Domain Coordinates for d1i6da_:

Click to download the PDB-style file with coordinates for d1i6da_.
(The format of our PDB-style files is described here.)

Timeline for d1i6da_: