SCOPe 2.04: Domain d1i56a_: 1i56 A:

Lineage for d1i56a_ (1i56 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Dog (Canis familiaris), milk [TaxId:9615] [53971] (4 PDB entries)

8. Domain d1i56a_: 1i56 A: [66033]
   holo-form

Details for d1i56a_

PDB Entry: 1i56

PDB Description: solution structure of ca2+-bound state of canine milk lysozyme

PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1i56a_:

Sequence; same for both SEQRES and ATOM records:

>d1i56a_ d.2.1.2 (A:) Lysozyme {Dog (Canis familiaris), milk [TaxId: 9615]}
skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
lskylascnl

Timeline for d1i56a_:

• d1i56a_ first appeared in SCOP 1.59
  
• d1i56a_ appears in SCOPe 2.03
  
• d1i56a_ appears in SCOPe 2.05
  
• d1i56a_ appears in the current release, SCOPe 2.08, called d1i56a1