Lineage for d1i4wa_ (1i4w A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399355Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 399356Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) (S)
  5. 399612Family c.66.1.24: rRNA adenine dimethylase-like [88784] (2 proteins)
  6. 399623Protein Transcription factor sc-mtTFB [69555] (1 species)
    overall structure is very similar to those of Ermc' and Ermam
  7. 399624Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69556] (1 PDB entry)
  8. 399625Domain d1i4wa_: 1i4w A: [66028]
    complexed with xe

Details for d1i4wa_

PDB Entry: 1i4w (more details), 2.6 Å

PDB Description: the crystal structure of the transcription factor sc-mttfb offers intriguing insights into mitochondrial transcription

SCOP Domain Sequences for d1i4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae)}
pipgikdisklkffygfkylwnptvynkifdkldltktykhpeelkvldlypgvgiqsai
fynkycprqysllekrsslykflnakfegsplqilkrdpydwstysnlideerifvpevq
ssdhindkfltvanvtgegseglimqwlscignknwlyrfgkvkmllwmpsttarkllar
pgmhsrskcsvvreaftdtkliaisdanelkgfdsqcieewdpilfsaaeiwptkgkpia
lvemdpidfdfdvdnwdyvtrhlmilkrtplntvmdslghggqqyfnsritdkdllkkcp
idltndefiyltklfmewpfkp

SCOP Domain Coordinates for d1i4wa_:

Click to download the PDB-style file with coordinates for d1i4wa_.
(The format of our PDB-style files is described here.)

Timeline for d1i4wa_: