Lineage for d1i3gl_ (1i3g L:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102010Species Anti-ampicillin scFv, (mouse), kappa L chain [63645] (4 PDB entries)
  8. 102014Domain d1i3gl_: 1i3g L: [66019]

Details for d1i3gl_

PDB Entry: 1i3g (more details), 2.44 Å

PDB Description: crystal structure of an ampicillin single chain fv, form 1, free

SCOP Domain Sequences for d1i3gl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3gl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Anti-ampicillin scFv, (mouse), kappa L chain}
divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklel

SCOP Domain Coordinates for d1i3gl_:

Click to download the PDB-style file with coordinates for d1i3gl_.
(The format of our PDB-style files is described here.)

Timeline for d1i3gl_: