Lineage for d1i3gh_ (1i3g H:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) 
Species Anti-ampicillin scFv, (mouse), kappa L chain [63645] (4 PDB entries) 
Domain d1i3gh_: 1i3g H: [66018]
Details for d1i3gh_
PDB Entry: 1i3g (more details), 2.44 Å
PDB Description: crystal structure of an ampicillin single chain fv, form 1, free
SCOP Domain Sequences for d1i3gh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3gh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anti-ampicillin scFv, (mouse), kappa L chain}
qvqlqqpgaelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny
nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvs
SCOP Domain Coordinates for d1i3gh_:
Click to download the PDB-style file with coordinates for d1i3gh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i3gh_:
- d1i3gh_ first appeared in SCOP 1.59
- d1i3gh_ appears in SCOP 1.63
- d1i3gh_ appears in the current release, SCOPe 2.08, called d1i3gh1
View in 3D
