Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Anti-ampicillin scFv, (mouse), kappa L chain [63645] (4 PDB entries) |
Domain d1i3gh_: 1i3g H: [66018] |
PDB Entry: 1i3g (more details), 2.44 Å
SCOP Domain Sequences for d1i3gh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i3gh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anti-ampicillin scFv, (mouse), kappa L chain} qvqlqqpgaelvrpgasvklsckasgytftsywinwvkqrpgqglewigniypsdsytny nqkfkdkatltvdkssstaymqlssltsedsavyfcarwgywgqgtlvtvs
Timeline for d1i3gh_: