Lineage for d1i33f2 (1i33 F:166-334)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414572Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 414573Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 414574Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 414598Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 414667Species Leishmania mexicana [TaxId:5665] [55357] (5 PDB entries)
  8. 414687Domain d1i33f2: 1i33 F:166-334 [66016]
    Other proteins in same PDB: d1i33a1, d1i33b1, d1i33c1, d1i33d1, d1i33e1, d1i33f1
    complexed with tnd

Details for d1i33f2

PDB Entry: 1i33 (more details), 3 Å

PDB Description: leishmania mexicana glyceraldehyde-3-phosphate dehydrogenase in complex with inhibitors

SCOP Domain Sequences for d1i33f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i33f2 d.81.1.1 (F:166-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
cttnclapivhvltkenfgietglmttihsytatqktvdgvslkdwrggraaavniipst
tgaakavgmvipstkgkltgmsfrvptpdvsvvdltfratrdtsiqeidkaikkaaqtym
kgilgftdeelvsadfindnrssvydskatlqnnlpgekrffkvvswyd

SCOP Domain Coordinates for d1i33f2:

Click to download the PDB-style file with coordinates for d1i33f2.
(The format of our PDB-style files is described here.)

Timeline for d1i33f2: