Lineage for d1i33a1 (1i33 A:1-165,A:335-358)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687423Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)
  7. 687509Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries)
  8. 687516Domain d1i33a1: 1i33 A:1-165,A:335-358 [66005]
    Other proteins in same PDB: d1i33a2, d1i33b2, d1i33c2, d1i33d2, d1i33e2, d1i33f2

Details for d1i33a1

PDB Entry: 1i33 (more details), 3 Å

PDB Description: leishmania mexicana glyceraldehyde-3-phosphate dehydrogenase in complex with inhibitors
PDB Compounds: (A:) glyceraldehyde 3-phosphate dehydrogenase

SCOP Domain Sequences for d1i33a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i33a1 c.2.1.3 (A:1-165,A:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana [TaxId: 5665]}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOP Domain Coordinates for d1i33a1:

Click to download the PDB-style file with coordinates for d1i33a1.
(The format of our PDB-style files is described here.)

Timeline for d1i33a1: