![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species) |
![]() | Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries) |
![]() | Domain d1i32e1: 1i32 E:1-165,E:335-358 [66001] Other proteins in same PDB: d1i32a2, d1i32b2, d1i32c2, d1i32d2, d1i32e2, d1i32f2 |
PDB Entry: 1i32 (more details), 2.6 Å
SCOP Domain Sequences for d1i32e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i32e1 c.2.1.3 (E:1-165,E:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana} apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr ymaakdaass
Timeline for d1i32e1: