Lineage for d1i1ea4 (1i1e A:534-861)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2268037Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2268051Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 2268052Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 2268053Protein Botulinum neurotoxin [58093] (2 species)
  7. 2268059Species Clostridium botulinum, serotype B [TaxId:1491] [58095] (14 PDB entries)
  8. 2268069Domain d1i1ea4: 1i1e A:534-861 [65981]
    Other proteins in same PDB: d1i1ea1, d1i1ea2, d1i1ea3
    complexed with dm2, so4, zn

Details for d1i1ea4

PDB Entry: 1i1e (more details), 2.5 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with doxorubicin
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1i1ea4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ea4 h.4.2.1 (A:534-861) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
ntifqylysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwv
kqivndfvieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillef
ipellipvvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfyt
ikegmykalnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnf
ingcsvsylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylkt
impfdlsiytndtiliemfnkynseiln

SCOPe Domain Coordinates for d1i1ea4:

Click to download the PDB-style file with coordinates for d1i1ea4.
(The format of our PDB-style files is described here.)

Timeline for d1i1ea4: