SCOPe 2.07: Domain d1i1ea2: 1i1e A:1080-1290

Lineage for d1i1ea2 (1i1e A:1080-1290)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein Botulinum neurotoxin [50402] (2 species)

7. Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (14 PDB entries)

8. Domain d1i1ea2: 1i1e A:1080-1290 [65979]
   Other proteins in same PDB: d1i1ea1, d1i1ea3, d1i1ea4
   complexed with dm2, so4, zn

Details for d1i1ea2

PDB Entry: 1i1e, 2.5 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with doxorubicin

PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1i1ea2:

Sequence; same for both SEQRES and ATOM records:

>d1i1ea2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

Timeline for d1i1ea2:

• d1i1ea2 first appeared in SCOP 1.59
  
• d1i1ea2 appears in SCOPe 2.06
  
• d1i1ea2 appears in the current release, SCOPe 2.08