Lineage for d1i09b_ (1i09 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138134Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
  7. 138135Species Human (Homo sapiens) [TaxId:9606] [69824] (2 PDB entries)
  8. 138139Domain d1i09b_: 1i09 B: [65977]

Details for d1i09b_

PDB Entry: 1i09 (more details), 2.7 Å

PDB Description: structure of glycogen synthase kinase-3 (gsk3b)

SCOP Domain Sequences for d1i09b_:

Sequence, based on SEQRES records: (download)

>d1i09b_ d.144.1.1 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
elqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpvi
yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
treqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleaca
hsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha

Sequence, based on observed residues (ATOM records): (download)

>d1i09b_ d.144.1.1 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
vttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknr
elqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpvi
yvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsy
icsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtp
treqiremnfkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffd
elrdpnvklpngrdtpalfnfttqelssnpplatilippha

SCOP Domain Coordinates for d1i09b_:

Click to download the PDB-style file with coordinates for d1i09b_.
(The format of our PDB-style files is described here.)

Timeline for d1i09b_: